PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.011G212000.1
Common NamePHAVU_011G212000g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 305aa    MW: 34486 Da    PI: 6.8538
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.011G212000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.73.7e-152269148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g W+++Ede+l+++    G g+W+ Iar  g+ R++k+c++rw +yl
  Phvul.011G212000.1 22 KGLWSPDEDEKLLRYMLTNGQGCWSDIARNAGLQRCGKSCRLRWINYL 69
                        678*******************************************97 PP

2Myb_DNA-binding47.44.6e-1575119147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         rg+++++E++l+ +++  lG++ W+ Ia++++ gRt++++k++w++ 
  Phvul.011G212000.1  75 RGAFSPQEQDLIFHLHSILGNR-WSQIAARLP-GRTDNEIKNFWNST 119
                         89********************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-221772IPR009057Homeodomain-like
PROSITE profilePS5129416.6481769IPR017930Myb domain
SuperFamilySSF466894.21E-2820116IPR009057Homeodomain-like
SMARTSM007178.6E-122171IPR001005SANT/Myb domain
PfamPF002498.2E-142269IPR001005SANT/Myb domain
CDDcd001671.89E-102569No hitNo description
PROSITE profilePS5129424.28570124IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.3E-2573125IPR009057Homeodomain-like
SMARTSM007173.5E-1574122IPR001005SANT/Myb domain
PfamPF002496.5E-1475119IPR001005SANT/Myb domain
CDDcd001676.35E-1177120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MRKPDLMANK DKKSDIKSKL RKGLWSPDED EKLLRYMLTN GQGCWSDIAR NAGLQRCGKS  60
CRLRWINYLR PDLKRGAFSP QEQDLIFHLH SILGNRWSQI AARLPGRTDN EIKNFWNSTL  120
KKRMKTNTST GSLNNSTDSS ESKDVVSGIM PLNEHDIMNM CMDSSSCISS MQGMVLPDQF  180
DPFAMLVNNQ CDMTNNVSED FLNISCMTQI GMVEGHQGNY GTLEPNNKMG LGRDFSLPSL  240
ESRSIEIDVK SHNNNHFNYG CFNNTDKIKG SKVEDLIGFG NHGQGEFYLE NLMQDITSFP  300
LLEF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-28201265110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150391e-106AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007133825.10.0hypothetical protein PHAVU_011G212000g
TrEMBLV7AJW20.0V7AJW2_PHAVU; Uncharacterized protein
STRINGGLYMA12G36630.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.12e-74myb domain protein 83